Anti-SPAM1

Catalog Number: ATA-HPA017984
Article Name: Anti-SPAM1
Biozol Catalog Number: ATA-HPA017984
Supplier Catalog Number: HPA017984
Alternative Catalog Number: ATA-HPA017984-100,ATA-HPA017984-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HYAL5, PH-20, SPAG15
sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding)
Anti-SPAM1
Clonality: Polyclonal
Isotype: IgG
NCBI: 6677
UniProt: P38567
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPM
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SPAM1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and liver tissues using HPA017984 antibody. Corresponding SPAM1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemical staining of human testis shows moderate membranous/cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and SPAM1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401088).
HPA017984-100ul
HPA017984-100ul
HPA017984-100ul