Anti-SPAM1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA017984
- Images (9)
| Article Name: | Anti-SPAM1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA017984 |
| Supplier Catalog Number: | HPA017984 |
| Alternative Catalog Number: | ATA-HPA017984-100,ATA-HPA017984-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HYAL5, PH-20, SPAG15 |
| sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding) |
| Anti-SPAM1 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 6677 |
| UniProt: | P38567 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPM |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SPAM1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and liver tissues using HPA017984 antibody. Corresponding SPAM1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected. |
|
|
Immunohistochemical staining of human testis shows moderate membranous/cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and SPAM1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401088). |
|
|
HPA017984 |
|
|
HPA017984 |
|
|
HPA017984 |
Product Guarantee and Expert Support
