Anti-DNAJC28

Artikelnummer: ATA-HPA018003
Artikelname: Anti-DNAJC28
Artikelnummer: ATA-HPA018003
Hersteller Artikelnummer: HPA018003
Alternativnummer: ATA-HPA018003-100,ATA-HPA018003-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C21orf55, C21orf78
DnaJ (Hsp40) homolog, subfamily C, member 28
Anti-DNAJC28
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 54943
UniProt: Q9NX36
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LIQESMAKGDFDNLSGKGKPLKKFSDCSYIDPMTHNLNRILIDNGYQPEWILKQKEISDTIEQLREAILVSRKKLGNPMTPTEKKQWNHVCEQF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAJC28
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.
HPA018003-100ul