Anti-DNAJC28

Catalog Number: ATA-HPA018003
Article Name: Anti-DNAJC28
Biozol Catalog Number: ATA-HPA018003
Supplier Catalog Number: HPA018003
Alternative Catalog Number: ATA-HPA018003-100,ATA-HPA018003-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Molekularbiologie
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C21orf55, C21orf78
DnaJ (Hsp40) homolog, subfamily C, member 28
Anti-DNAJC28
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 54943
UniProt: Q9NX36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LIQESMAKGDFDNLSGKGKPLKKFSDCSYIDPMTHNLNRILIDNGYQPEWILKQKEISDTIEQLREAILVSRKKLGNPMTPTEKKQWNHVCEQF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DNAJC28
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.
HPA018003-100ul