Anti-IFNAR1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA018015
Artikelname: Anti-IFNAR1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA018015
Hersteller Artikelnummer: HPA018015
Alternativnummer: ATA-HPA018015-100,ATA-HPA018015-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: IFNAR, IFRC
interferon (alpha, beta and omega) receptor 1
Anti-IFNAR1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 3454
UniProt: P17181
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KWKQIPDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLN
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IFNAR1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemical staining of human kidney shows strong positivity in extracellular matrix in cells in tubules.
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in monocytes as expected.
Immunohistochemical staining of human placenta shows strong positivity in extracellular matrix in trophoblastic cells.
HPA018015
HPA018015
HPA018015