Anti-IFNAR1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-IFNAR1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA018015
• Supplier Catalog Number: HPA018015
• Alternative Catalog Number: ATA-HPA018015-100,ATA-HPA018015-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: IFNAR, IFRC

Product Description

interferon (alpha, beta and omega) receptor 1

Additional Information

Anti-IFNAR1

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 3454
• UniProt: P17181
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: KWKQIPDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLN
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: IFNAR1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemical staining of human kidney shows strong positivity in extracellular matrix in cells in tubules.

Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.

Immunohistochemical staining of human skeletal muscle shows no positivity in monocytes as expected.

Immunohistochemical staining of human placenta shows strong positivity in extracellular matrix in trophoblastic cells.

HPA018015

HPA018015

HPA018015