Anti-IFNAR1

Catalog Number: ATA-HPA018015
Article Name: Anti-IFNAR1
Biozol Catalog Number: ATA-HPA018015
Supplier Catalog Number: HPA018015
Alternative Catalog Number: ATA-HPA018015-100,ATA-HPA018015-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IFNAR, IFRC
interferon (alpha, beta and omega) receptor 1
Anti-IFNAR1
Clonality: Polyclonal
Isotype: IgG
NCBI: 3454
UniProt: P17181
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KWKQIPDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IFNAR1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemical staining of human kidney shows strong positivity in extracellular matrix in cells in tubules.
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in monocytes as expected.
Immunohistochemical staining of human placenta shows strong positivity in extracellular matrix in trophoblastic cells.
HPA018015-100ul
HPA018015-100ul
HPA018015-100ul