Anti-SLC12A1

Artikelnummer: ATA-HPA018107
Artikelname: Anti-SLC12A1
Artikelnummer: ATA-HPA018107
Hersteller Artikelnummer: HPA018107
Alternativnummer: ATA-HPA018107-100,ATA-HPA018107-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: NKCC2
solute carrier family 12 (sodium/potassium/chloride transporter), member 1
Anti-SLC12A1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 6557
UniProt: Q13621
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SQGFDISQVLQVQEELERLEQERLALEATIKDNECEEESGGIRGLFKKAGKLNITKTTPKKDGSINTSQSMHVGEFNQKLVEASTQFKKKQEKGTIDVWWLFDD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SLC12A1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-SLC12A1 antibody. Corresponding SLC12A1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, kidney, liver and lymph node using Anti-SLC12A1 antibody HPA018107 (A) shows similar protein distribution across tissues to independent antibody HPA014967 (B).
Immunohistochemical staining of human kidney shows high expression.
Immunohistochemical staining of human lymph node shows low expression as expected.
Immunohistochemical staining of human cerebral cortex using Anti-SLC12A1 antibody HPA018107.
Immunohistochemical staining of human liver using Anti-SLC12A1 antibody HPA018107.
HPA018107-100ul
HPA018107-100ul
HPA018107-100ul