Anti-SLC12A1

Catalog Number: ATA-HPA018107
Article Name: Anti-SLC12A1
Biozol Catalog Number: ATA-HPA018107
Supplier Catalog Number: HPA018107
Alternative Catalog Number: ATA-HPA018107-100,ATA-HPA018107-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NKCC2
solute carrier family 12 (sodium/potassium/chloride transporter), member 1
Anti-SLC12A1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 6557
UniProt: Q13621
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SQGFDISQVLQVQEELERLEQERLALEATIKDNECEEESGGIRGLFKKAGKLNITKTTPKKDGSINTSQSMHVGEFNQKLVEASTQFKKKQEKGTIDVWWLFDD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SLC12A1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-SLC12A1 antibody. Corresponding SLC12A1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, kidney, liver and lymph node using Anti-SLC12A1 antibody HPA018107 (A) shows similar protein distribution across tissues to independent antibody HPA014967 (B).
Immunohistochemical staining of human kidney shows high expression.
Immunohistochemical staining of human lymph node shows low expression as expected.
Immunohistochemical staining of human cerebral cortex using Anti-SLC12A1 antibody HPA018107.
Immunohistochemical staining of human liver using Anti-SLC12A1 antibody HPA018107.
HPA018107-100ul
HPA018107-100ul
HPA018107-100ul