Anti-SLC12A1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SLC12A1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA018107
• Supplier Catalog Number: HPA018107
• Alternative Catalog Number: ATA-HPA018107-100,ATA-HPA018107-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: NKCC2

Product Description

solute carrier family 12 (sodium/potassium/chloride transporter), member 1

Additional Information

Anti-SLC12A1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 6557
• UniProt: Q13621
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: SQGFDISQVLQVQEELERLEQERLALEATIKDNECEEESGGIRGLFKKAGKLNITKTTPKKDGSINTSQSMHVGEFNQKLVEASTQFKKKQEKGTIDVWWLFDD
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SLC12A1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:1000 - 1:2500

Images

Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-SLC12A1 antibody. Corresponding SLC12A1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, kidney, liver and lymph node using Anti-SLC12A1 antibody HPA018107 (A) shows similar protein distribution across tissues to independent antibody HPA014967 (B).

Immunohistochemical staining of human kidney shows high expression.

Immunohistochemical staining of human lymph node shows low expression as expected.

Immunohistochemical staining of human cerebral cortex using Anti-SLC12A1 antibody HPA018107.

Immunohistochemical staining of human liver using Anti-SLC12A1 antibody HPA018107.

HPA018107

HPA018107

HPA018107