Anti-TTBK2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA018113
Artikelname: Anti-TTBK2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA018113
Hersteller Artikelnummer: HPA018113
Alternativnummer: ATA-HPA018113-100,ATA-HPA018113-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0847, SCA11
tau tubulin kinase 2
Anti-TTBK2
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 146057
UniProt: Q6IQ55
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TTEPLDVTKTQTFSVVPNQDKNNEIMKLLTVGTSEISSRDIDPHVEGQIGQVAEMQKNKISKDDDIMSEDLPGHQGDLSTFLHQEGKREKITPRNGELFHCVS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TTBK2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes.
Immunohistochemical staining of human Fallopian tube shows strong positivity in cilia in glandular cells.
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Western blot analysis in control (vector only transfected HEK293T lysate) and TTBK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406582).
HPA018113
HPA018113
HPA018113