Anti-TTBK2

Catalog Number: ATA-HPA018113
Article Name: Anti-TTBK2
Biozol Catalog Number: ATA-HPA018113
Supplier Catalog Number: HPA018113
Alternative Catalog Number: ATA-HPA018113-100,ATA-HPA018113-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0847, SCA11
tau tubulin kinase 2
Anti-TTBK2
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 146057
UniProt: Q6IQ55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TTEPLDVTKTQTFSVVPNQDKNNEIMKLLTVGTSEISSRDIDPHVEGQIGQVAEMQKNKISKDDDIMSEDLPGHQGDLSTFLHQEGKREKITPRNGELFHCVS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TTBK2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes.
Immunohistochemical staining of human Fallopian tube shows strong positivity in cilia in glandular cells.
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Western blot analysis in control (vector only transfected HEK293T lysate) and TTBK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406582).
HPA018113-100ul
HPA018113-100ul
HPA018113-100ul