Anti-GNAS Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA018122
Artikelname: Anti-GNAS Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA018122
Hersteller Artikelnummer: HPA018122
Alternativnummer: ATA-HPA018122-100,ATA-HPA018122-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GNAS1, GNASXL, GPSA, NESP, NESP55, SCG6
GNAS complex locus
Anti-GNAS
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Isotyp: IgG
NCBI: 2778
UniProt: O95467
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GNAS
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human skin shows no positivity in squamous epithelial cells.
Immunohistochemical staining of human duodenum shows moderate positivity in mucus in glandular cells.
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
Immunohistochemical staining of human liver shows no positivity in hepatocytes.
Western blot analysis in control (vector only transfected HEK293T lysate) and GNAS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402577).
HPA018122
HPA018122
HPA018122