Anti-GNAS Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA018122
- Images (9)
| Article Name: | Anti-GNAS Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA018122 |
| Supplier Catalog Number: | HPA018122 |
| Alternative Catalog Number: | ATA-HPA018122-100,ATA-HPA018122-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GNAS1, GNASXL, GPSA, NESP, NESP55, SCG6 |
| GNAS complex locus |
| Anti-GNAS |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Isotype: | IgG |
| NCBI: | 2778 |
| UniProt: | O95467 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GNAS |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human skin shows no positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human duodenum shows moderate positivity in mucus in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and GNAS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402577). |
|
|
HPA018122 |
|
|
|
|
|
HPA018122 |
|
|
HPA018122 |
Product Guarantee and Expert Support
