Anti-GNAS

Catalog Number: ATA-HPA018122
Article Name: Anti-GNAS
Biozol Catalog Number: ATA-HPA018122
Supplier Catalog Number: HPA018122
Alternative Catalog Number: ATA-HPA018122-100,ATA-HPA018122-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GNAS1, GNASXL, GPSA, NESP, NESP55, SCG6
GNAS complex locus
Anti-GNAS
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Isotype: IgG
NCBI: 2778
UniProt: O95467
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GNAS
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human skin shows no positivity in squamous epithelial cells.
Immunohistochemical staining of human duodenum shows moderate positivity in mucus in glandular cells.
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
Immunohistochemical staining of human liver shows no positivity in hepatocytes.
Western blot analysis in control (vector only transfected HEK293T lysate) and GNAS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402577).
HPA018122-100ul
HPA018122-100ul
HPA018122-100ul