Anti-TES Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA018123
- Bilder (9)
| Artikelname: | Anti-TES Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA018123 |
| Hersteller Artikelnummer: | HPA018123 |
| Alternativnummer: | ATA-HPA018123-100,ATA-HPA018123-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZP586B2022, TESS-2, TESTIN |
| testis derived transcript (3 LIM domains) |
| Anti-TES |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 26136 |
| UniProt: | Q9UGI8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | YCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TES |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line SiHa shows localization to plasma membrane, cytosol & focal adhesion sites. |
|
|
Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines A-431 and U-251MG using Anti-TES antibody. Corresponding TES RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis using Anti-TES antibody HPA018123 (A) shows similar pattern to independent antibody HPA015269 (B). |
|
|
HPA018123 |
|
|
|
|
|
|
|
|
HPA018123 |
|
|
HPA018123 |
Produktgarantie und fachkundiger Support
