Anti-TES Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA018123
Article Name: Anti-TES Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA018123
Supplier Catalog Number: HPA018123
Alternative Catalog Number: ATA-HPA018123-100,ATA-HPA018123-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZP586B2022, TESS-2, TESTIN
testis derived transcript (3 LIM domains)
Anti-TES
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 26136
UniProt: Q9UGI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TES
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line SiHa shows localization to plasma membrane, cytosol & focal adhesion sites.
Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Western blot analysis in human cell lines A-431 and U-251MG using Anti-TES antibody. Corresponding TES RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Western blot analysis using Anti-TES antibody HPA018123 (A) shows similar pattern to independent antibody HPA015269 (B).
HPA018123
HPA018123
HPA018123