Anti-HHATL
Artikelnummer:
ATA-HPA018174
- Bilder (8)
| Artikelname: | Anti-HHATL |
| Artikelnummer: | ATA-HPA018174 |
| Hersteller Artikelnummer: | HPA018174 |
| Alternativnummer: | ATA-HPA018174-100,ATA-HPA018174-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C3orf3, GUP1, KIAA1173, MBOAT3, MSTP002, OACT3 |
| hedgehog acyltransferase-like |
| Anti-HHATL |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 57467 |
| UniProt: | Q9HCP6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ASFKMDPLISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLADLLKYNFYLPFFFFGPIMTFDRFHAQVSQVEPVRREGELWHIRAQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HHATL |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human heart muscle and prostate tissues using HPA018174 antibody. Corresponding HHATL RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected. |
|
|
HPA018174-100ul |
|
|
HPA018174-100ul |
|
|
HPA018174-100ul |
Produktgarantie und fachkundiger Support
