Anti-HHATL
Catalog Number:
ATA-HPA018174
- Images (8)
| Article Name: | Anti-HHATL |
| Biozol Catalog Number: | ATA-HPA018174 |
| Supplier Catalog Number: | HPA018174 |
| Alternative Catalog Number: | ATA-HPA018174-100,ATA-HPA018174-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C3orf3, GUP1, KIAA1173, MBOAT3, MSTP002, OACT3 |
| hedgehog acyltransferase-like |
| Anti-HHATL |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 57467 |
| UniProt: | Q9HCP6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ASFKMDPLISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLADLLKYNFYLPFFFFGPIMTFDRFHAQVSQVEPVRREGELWHIRAQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HHATL |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human heart muscle and prostate tissues using HPA018174 antibody. Corresponding HHATL RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected. |
|
|
HPA018174-100ul |
|
|
HPA018174-100ul |
|
|
HPA018174-100ul |
Product Guarantee and Expert Support
