Anti-CHAD
Artikelnummer:
ATA-HPA018241
- Bilder (8)
| Artikelname: | Anti-CHAD |
| Artikelnummer: | ATA-HPA018241 |
| Hersteller Artikelnummer: | HPA018241 |
| Alternativnummer: | ATA-HPA018241-100,ATA-HPA018241-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SLRR4A |
| chondroadherin |
| Anti-CHAD |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1101 |
| UniProt: | O15335 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CHAD |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human cervix, uterine and tonsil tissues using Anti-CHAD antibody. Corresponding CHAD RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cervix, uterine shows high expression. |
|
|
Immunohistochemical staining of human tonsil shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA018241-100ul |
|
|
HPA018241-100ul |
|
|
HPA018241-100ul |
Produktgarantie und fachkundiger Support
