Anti-CHAD

Catalog Number: ATA-HPA018241
Article Name: Anti-CHAD
Biozol Catalog Number: ATA-HPA018241
Supplier Catalog Number: HPA018241
Alternative Catalog Number: ATA-HPA018241-100,ATA-HPA018241-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SLRR4A
chondroadherin
Anti-CHAD
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 1101
UniProt: O15335
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CHAD
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human cervix, uterine and tonsil tissues using Anti-CHAD antibody. Corresponding CHAD RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cervix, uterine shows high expression.
Immunohistochemical staining of human tonsil shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA018241-100ul
HPA018241-100ul
HPA018241-100ul