Anti-MIS18A
Artikelnummer:
ATA-HPA018286
- Bilder (8)
| Artikelname: | Anti-MIS18A |
| Artikelnummer: | ATA-HPA018286 |
| Hersteller Artikelnummer: | HPA018286 |
| Alternativnummer: | ATA-HPA018286-100,ATA-HPA018286-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | B28, C21orf45, C21orf46, FASP1, hMis18alpha |
| MIS18 kinetochore protein A |
| Anti-MIS18A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 54069 |
| UniProt: | Q9NYP9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATC |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MIS18A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-MIS18A antibody. Corresponding MIS18A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line NTERA-2 |
|
|
HPA018286-100ul |
|
|
|
|
|
HPA018286-100ul |
|
|
HPA018286-100ul |
Produktgarantie und fachkundiger Support
