Anti-MIS18A

Catalog Number: ATA-HPA018286
Article Name: Anti-MIS18A
Biozol Catalog Number: ATA-HPA018286
Supplier Catalog Number: HPA018286
Alternative Catalog Number: ATA-HPA018286-100,ATA-HPA018286-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: B28, C21orf45, C21orf46, FASP1, hMis18alpha
MIS18 kinetochore protein A
Anti-MIS18A
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 54069
UniProt: Q9NYP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATC
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MIS18A
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-MIS18A antibody. Corresponding MIS18A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line NTERA-2
HPA018286-100ul
HPA018286-100ul
HPA018286-100ul