Anti-UPK3A

Artikelnummer: ATA-HPA018407
Artikelname: Anti-UPK3A
Artikelnummer: ATA-HPA018407
Hersteller Artikelnummer: HPA018407
Alternativnummer: ATA-HPA018407-100,ATA-HPA018407-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: UPK3
uroplakin 3A
Anti-UPK3A
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 7380
UniProt: O75631
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QILNAYLVRVGANGTCLWDPNFQGLCNPPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGGMIVIT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: UPK3A
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human urinary bladder and kidney tissues using Anti-UPK3A antibody. Corresponding UPK3A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, kidney, liver and urinary bladder using Anti-UPK3A antibody HPA018407 (A) shows similar protein distribution across tissues to independent antibody HPA018415 (B).
Immunohistochemical staining of human urinary bladder shows high expression.
Immunohistochemical staining of human kidney shows low expression as expected.
Immunohistochemical staining of human colon using Anti-UPK3A antibody HPA018407.
Immunohistochemical staining of human liver using Anti-UPK3A antibody HPA018407.
HPA018407-100ul
HPA018407-100ul
HPA018407-100ul