Anti-UPK3A

Catalog Number: ATA-HPA018407
Article Name: Anti-UPK3A
Biozol Catalog Number: ATA-HPA018407
Supplier Catalog Number: HPA018407
Alternative Catalog Number: ATA-HPA018407-100,ATA-HPA018407-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: UPK3
uroplakin 3A
Anti-UPK3A
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 7380
UniProt: O75631
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QILNAYLVRVGANGTCLWDPNFQGLCNPPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGGMIVIT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: UPK3A
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human urinary bladder and kidney tissues using Anti-UPK3A antibody. Corresponding UPK3A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, kidney, liver and urinary bladder using Anti-UPK3A antibody HPA018407 (A) shows similar protein distribution across tissues to independent antibody HPA018415 (B).
Immunohistochemical staining of human urinary bladder shows high expression.
Immunohistochemical staining of human kidney shows low expression as expected.
Immunohistochemical staining of human colon using Anti-UPK3A antibody HPA018407.
Immunohistochemical staining of human liver using Anti-UPK3A antibody HPA018407.
HPA018407-100ul
HPA018407-100ul
HPA018407-100ul