Anti-UPK3A Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-UPK3A Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA018407
• Supplier Catalog Number: HPA018407
• Alternative Catalog Number: ATA-HPA018407-100,ATA-HPA018407-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: UPK3

Product Description

uroplakin 3A

Additional Information

Anti-UPK3A

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 7380
• UniProt: O75631
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: QILNAYLVRVGANGTCLWDPNFQGLCNPPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGGMIVIT
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: UPK3A
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500

Images

Immunohistochemistry analysis in human urinary bladder and kidney tissues using Anti-UPK3A antibody. Corresponding UPK3A RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human colon, kidney, liver and urinary bladder using Anti-UPK3A antibody HPA018407 (A) shows similar protein distribution across tissues to independent antibody HPA018415 (B).

Immunohistochemical staining of human urinary bladder shows high expression.

Immunohistochemical staining of human kidney shows low expression as expected.

Immunohistochemical staining of human colon using Anti-UPK3A antibody HPA018407.

Immunohistochemical staining of human liver using Anti-UPK3A antibody HPA018407.

HPA018407

HPA018407

HPA018407