Anti-IL16
Artikelnummer:
ATA-HPA018467
- Bilder (8)
| Artikelname: | Anti-IL16 |
| Artikelnummer: | ATA-HPA018467 |
| Hersteller Artikelnummer: | HPA018467 |
| Alternativnummer: | ATA-HPA018467-100,ATA-HPA018467-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ16806, FLJ42735, HsT19289, IL-16, LCF, prIL-16 |
| interleukin 16 |
| Anti-IL16 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3603 |
| UniProt: | Q14005 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | IL16 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus, plasma membrane & cytoplasm. |
|
|
Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-IL16 antibody. Corresponding IL16 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
HPA018467-100ul |
|
|
|
|
|
HPA018467-100ul |
|
|
HPA018467-100ul |
Produktgarantie und fachkundiger Support
