Anti-IL16

Catalog Number: ATA-HPA018467
Article Name: Anti-IL16
Biozol Catalog Number: ATA-HPA018467
Supplier Catalog Number: HPA018467
Alternative Catalog Number: ATA-HPA018467-100,ATA-HPA018467-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ16806, FLJ42735, HsT19289, IL-16, LCF, prIL-16
interleukin 16
Anti-IL16
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Isotype: IgG
NCBI: 3603
UniProt: Q14005
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IL16
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus, plasma membrane & cytoplasm.
Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-IL16 antibody. Corresponding IL16 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
HPA018467-100ul
HPA018467-100ul
HPA018467-100ul