Anti-AIMP1

Artikelnummer: ATA-HPA018476
Artikelname: Anti-AIMP1
Artikelnummer: ATA-HPA018476
Hersteller Artikelnummer: HPA018476
Alternativnummer: ATA-HPA018476-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: EMAP-2, EMAPII, p43, SCYE1
aminoacyl tRNA synthetase complex-interacting multifunctional protein 1
Anti-AIMP1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 9255
UniProt: Q12904
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: CNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: AIMP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemical staining of human hippocampus shows distinct cytoplasmic positivity in neuronal cells.
Western blot analysis in SK-BR-3 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-AIMP1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA018476-100ul
HPA018476-100ul
HPA018476-100ul