Anti-AIMP1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA018476
- Images (9)
| Article Name: | Anti-AIMP1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA018476 |
| Supplier Catalog Number: | HPA018476 |
| Alternative Catalog Number: | ATA-HPA018476-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | EMAP-2, EMAPII, p43, SCYE1 |
| aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 |
| Anti-AIMP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 9255 |
| UniProt: | Q12904 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | CNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | AIMP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. |
|
|
Immunohistochemical staining of human hippocampus shows distinct cytoplasmic positivity in neuronal cells. |
|
|
Western blot analysis in SK-BR-3 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-AIMP1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
|
|
|
HPA018476 |
|
|
|
|
|
HPA018476 |
|
|
HPA018476 |
Product Guarantee and Expert Support
