Anti-FOS Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA018531
Artikelname: Anti-FOS Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA018531
Hersteller Artikelnummer: HPA018531
Alternativnummer: ATA-HPA018531-100,ATA-HPA018531-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: AP-1, c-fos
FBJ murine osteosarcoma viral oncogene homolog
Anti-FOS
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 2353
UniProt: P01100
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FOS
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemical staining of human stomach shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemical staining of human kidney shows weak to moderate nuclear positivity in cells in tubules.
Immunohistochemical staining of human pancreas shows very weak and few nuclear positivity in exocrine glandular cells.
HPA018531
HPA018531
HPA018531