Anti-FOS

Catalog Number: ATA-HPA018531
Article Name: Anti-FOS
Biozol Catalog Number: ATA-HPA018531
Supplier Catalog Number: HPA018531
Alternative Catalog Number: ATA-HPA018531-100,ATA-HPA018531-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ChIP, ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AP-1, c-fos
FBJ murine osteosarcoma viral oncogene homolog
Anti-FOS
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 2353
UniProt: P01100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FOS
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemical staining of human stomach shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemical staining of human kidney shows weak to moderate nuclear positivity in cells in tubules.
Immunohistochemical staining of human pancreas shows very weak and few nuclear positivity in exocrine glandular cells.
HPA018531-100ul
HPA018531-100ul
HPA018531-100ul