Anti-FOS Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA018531
- Images (9)
| Article Name: | Anti-FOS Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA018531 |
| Supplier Catalog Number: | HPA018531 |
| Alternative Catalog Number: | ATA-HPA018531-100,ATA-HPA018531-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AP-1, c-fos |
| FBJ murine osteosarcoma viral oncogene homolog |
| Anti-FOS |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 2353 |
| UniProt: | P01100 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FOS |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human stomach shows moderate to strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows weak to moderate nuclear positivity in cells in tubules. |
|
|
Immunohistochemical staining of human pancreas shows very weak and few nuclear positivity in exocrine glandular cells. |
|
|
HPA018531 |
|
|
|
|
|
HPA018531 |
|
|
HPA018531 |
Product Guarantee and Expert Support
