Anti-FAIM2

Artikelnummer: ATA-HPA018790
Artikelname: Anti-FAIM2
Artikelnummer: ATA-HPA018790
Hersteller Artikelnummer: HPA018790
Alternativnummer: ATA-HPA018790-100,ATA-HPA018790-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0950, LFG, LFG2, LIFEGUARD, NMP35, TMBIM2
Fas apoptotic inhibitory molecule 2
Anti-FAIM2
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 23017
UniProt: Q9BWQ8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FAIM2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-FAIM2 antibody. Corresponding FAIM2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, kidney, lymph node and pancreas using Anti-FAIM2 antibody HPA018790 (A) shows similar protein distribution across tissues to independent antibody HPA048800 (B).
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human lymph node using Anti-FAIM2 antibody HPA018790.
Immunohistochemical staining of human kidney using Anti-FAIM2 antibody HPA018790.
HPA018790-100ul
HPA018790-100ul
HPA018790-100ul