Anti-FAIM2 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-FAIM2 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA018790
• Supplier Catalog Number: HPA018790
• Alternative Catalog Number: ATA-HPA018790-100,ATA-HPA018790-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: KIAA0950, LFG, LFG2, LIFEGUARD, NMP35, TMBIM2

Product Description

Fas apoptotic inhibitory molecule 2

Additional Information

Anti-FAIM2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 23017
• UniProt: Q9BWQ8
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: FAIM2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-FAIM2 antibody. Corresponding FAIM2 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, kidney, lymph node and pancreas using Anti-FAIM2 antibody HPA018790 (A) shows similar protein distribution across tissues to independent antibody HPA048800 (B).

Immunohistochemical staining of human pancreas shows low expression as expected.

Immunohistochemical staining of human cerebral cortex shows high expression.

Immunohistochemical staining of human lymph node using Anti-FAIM2 antibody HPA018790.

Immunohistochemical staining of human kidney using Anti-FAIM2 antibody HPA018790.

HPA018790

HPA018790

HPA018790