Anti-FAIM2
Catalog Number:
ATA-HPA018790
- Images (9)
| Article Name: | Anti-FAIM2 |
| Biozol Catalog Number: | ATA-HPA018790 |
| Supplier Catalog Number: | HPA018790 |
| Alternative Catalog Number: | ATA-HPA018790-100,ATA-HPA018790-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0950, LFG, LFG2, LIFEGUARD, NMP35, TMBIM2 |
| Fas apoptotic inhibitory molecule 2 |
| Anti-FAIM2 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 23017 |
| UniProt: | Q9BWQ8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FAIM2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-FAIM2 antibody. Corresponding FAIM2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, kidney, lymph node and pancreas using Anti-FAIM2 antibody HPA018790 (A) shows similar protein distribution across tissues to independent antibody HPA048800 (B). |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human lymph node using Anti-FAIM2 antibody HPA018790. |
|
|
Immunohistochemical staining of human kidney using Anti-FAIM2 antibody HPA018790. |
|
|
HPA018790-100ul |
|
|
HPA018790-100ul |
|
|
HPA018790-100ul |
Product Guarantee and Expert Support
