Anti-FAIM2

Catalog Number: ATA-HPA018790
Article Name: Anti-FAIM2
Biozol Catalog Number: ATA-HPA018790
Supplier Catalog Number: HPA018790
Alternative Catalog Number: ATA-HPA018790-100,ATA-HPA018790-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0950, LFG, LFG2, LIFEGUARD, NMP35, TMBIM2
Fas apoptotic inhibitory molecule 2
Anti-FAIM2
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 23017
UniProt: Q9BWQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FAIM2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-FAIM2 antibody. Corresponding FAIM2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, kidney, lymph node and pancreas using Anti-FAIM2 antibody HPA018790 (A) shows similar protein distribution across tissues to independent antibody HPA048800 (B).
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human lymph node using Anti-FAIM2 antibody HPA018790.
Immunohistochemical staining of human kidney using Anti-FAIM2 antibody HPA018790.
HPA018790-100ul
HPA018790-100ul
HPA018790-100ul