Anti-APOL1
Artikelnummer:
ATA-HPA018885
- Bilder (8)
| Artikelname: | Anti-APOL1 |
| Artikelnummer: | ATA-HPA018885 |
| Hersteller Artikelnummer: | HPA018885 |
| Alternativnummer: | ATA-HPA018885-100,ATA-HPA018885-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | APOL |
| apolipoprotein L, 1 |
| Anti-APOL1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8542 |
| UniProt: | O14791 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | APOL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human skin shows strong positivity in plasma in blood vessels. |
|
|
Immunohistochemical staining of human colon shows moderate to strong positivity in plasma in blood vessels. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected. |
|
|
Western blot analysis in human cell lines A-431 and MCF-7 using Anti-APOL1 antibody. Corresponding APOL1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
HPA018885-100ul |
|
|
|
|
|
HPA018885-100ul |
|
|
HPA018885-100ul |
Produktgarantie und fachkundiger Support
