Anti-APOL1
Catalog Number:
ATA-HPA018885
- Images (8)
| Article Name: | Anti-APOL1 |
| Biozol Catalog Number: | ATA-HPA018885 |
| Supplier Catalog Number: | HPA018885 |
| Alternative Catalog Number: | ATA-HPA018885-100,ATA-HPA018885-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | APOL |
| apolipoprotein L, 1 |
| Anti-APOL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 8542 |
| UniProt: | O14791 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | APOL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human skin shows strong positivity in plasma in blood vessels. |
|
|
Immunohistochemical staining of human colon shows moderate to strong positivity in plasma in blood vessels. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected. |
|
|
Western blot analysis in human cell lines A-431 and MCF-7 using Anti-APOL1 antibody. Corresponding APOL1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
HPA018885-100ul |
|
|
|
|
|
HPA018885-100ul |
|
|
HPA018885-100ul |
Product Guarantee and Expert Support
