Anti-UTRN Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA018894
Artikelname: Anti-UTRN Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA018894
Hersteller Artikelnummer: HPA018894
Alternativnummer: ATA-HPA018894-100,ATA-HPA018894-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DMDL, DRP, DRP1
utrophin
Anti-UTRN
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 7402
UniProt: P46939
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GELDKQLTTYLTDRIDAFQVPQEAQKIQAEISAHELTLEELRRNMRSQPLTSPESRTARGGSQMDVLQRKLREVSTKFQLFQKPANFEQRMLDCKRVLDGVKAELHVLDVKDVDPDVIQTHLDKCMKLYKTLSEVKLEVETVI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: UTRN
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & plasma membrane.
Immunohistochemical staining of human prostate shows moderate to strong membranous positivity in glandular cells.
Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in glomeruli and i cells in tubules.
Immunohistochemical staining of human stomach shows moderate membranous positivity in glandular cells.
Immunohistochemical staining of human liver shows no membranous positivity in hepatocytes as expected.
HPA018894
HPA018894
HPA018894
HPA018894