Anti-UTRN
Artikelnummer:
ATA-HPA018894
- Bilder (9)
| Artikelname: | Anti-UTRN |
| Artikelnummer: | ATA-HPA018894 |
| Hersteller Artikelnummer: | HPA018894 |
| Alternativnummer: | ATA-HPA018894-100,ATA-HPA018894-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DMDL, DRP, DRP1 |
| utrophin |
| Anti-UTRN |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7402 |
| UniProt: | P46939 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GELDKQLTTYLTDRIDAFQVPQEAQKIQAEISAHELTLEELRRNMRSQPLTSPESRTARGGSQMDVLQRKLREVSTKFQLFQKPANFEQRMLDCKRVLDGVKAELHVLDVKDVDPDVIQTHLDKCMKLYKTLSEVKLEVETVI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | UTRN |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & plasma membrane. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in glomeruli and i cells in tubules. |
|
|
Immunohistochemical staining of human stomach shows moderate membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows no membranous positivity in hepatocytes as expected. |
|
|
HPA018894 |
|
|
HPA018894-100ul |
|
|
HPA018894 |
|
|
HPA018894 |
Produktgarantie und fachkundiger Support
