Anti-UTRN
Catalog Number:
ATA-HPA018894
- Images (9)
| Article Name: | Anti-UTRN |
| Biozol Catalog Number: | ATA-HPA018894 |
| Supplier Catalog Number: | HPA018894 |
| Alternative Catalog Number: | ATA-HPA018894-100,ATA-HPA018894-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DMDL, DRP, DRP1 |
| utrophin |
| Anti-UTRN |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 7402 |
| UniProt: | P46939 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GELDKQLTTYLTDRIDAFQVPQEAQKIQAEISAHELTLEELRRNMRSQPLTSPESRTARGGSQMDVLQRKLREVSTKFQLFQKPANFEQRMLDCKRVLDGVKAELHVLDVKDVDPDVIQTHLDKCMKLYKTLSEVKLEVETVI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | UTRN |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & plasma membrane. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in glomeruli and i cells in tubules. |
|
|
Immunohistochemical staining of human stomach shows moderate membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows no membranous positivity in hepatocytes as expected. |
|
|
HPA018894 |
|
|
HPA018894-100ul |
|
|
HPA018894 |
|
|
HPA018894 |
Product Guarantee and Expert Support
