Anti-TMEM150A Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA019015
Artikelname: Anti-TMEM150A Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA019015
Hersteller Artikelnummer: HPA019015
Alternativnummer: ATA-HPA019015-100,ATA-HPA019015-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ90024, TM6P1, TMEM150
transmembrane protein 150A
Anti-TMEM150A
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 129303
UniProt: Q86TG1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLDDVPLISKCGSYP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TMEM150A
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
Immunohistochemical staining of human endometrium shows moderate granular cytoplasmic positivity in glandular cells.
HPA019015
HPA019015
HPA019015