Anti-TMEM150A Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-TMEM150A Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA019015
• Supplier Catalog Number: HPA019015
• Alternative Catalog Number: ATA-HPA019015-100,ATA-HPA019015-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ90024, TM6P1, TMEM150

Product Description

transmembrane protein 150A

Additional Information

Anti-TMEM150A

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 129303
• UniProt: Q86TG1
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: VMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLDDVPLISKCGSYP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: TMEM150A
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200

Images

Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.

Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemical staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.

Immunohistochemical staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.

Immunohistochemical staining of human endometrium shows moderate granular cytoplasmic positivity in glandular cells.

HPA019015

HPA019015

HPA019015