Anti-TMEM150A

Catalog Number: ATA-HPA019015
Article Name: Anti-TMEM150A
Biozol Catalog Number: ATA-HPA019015
Supplier Catalog Number: HPA019015
Alternative Catalog Number: ATA-HPA019015-100,ATA-HPA019015-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ90024, TM6P1, TMEM150
transmembrane protein 150A
Anti-TMEM150A
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 129303
UniProt: Q86TG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLDDVPLISKCGSYP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TMEM150A
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
Immunohistochemical staining of human endometrium shows moderate granular cytoplasmic positivity in glandular cells.
HPA019015-100ul
HPA019015-100ul
HPA019015-100ul