Anti-TET1

Artikelnummer: ATA-HPA019032
Artikelname: Anti-TET1
Artikelnummer: ATA-HPA019032
Hersteller Artikelnummer: HPA019032
Alternativnummer: ATA-HPA019032-100,ATA-HPA019032-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: bA119F7.1, CXXC6, KIAA1676, LCX
tet methylcytosine dioxygenase 1
Anti-TET1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 80312
UniProt: Q8NFU7
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSSSNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSKSDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TET1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear membrane.
Immunohistochemical staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in purkinje cells.
Immunohistochemical staining of human cervix, uterine shows moderate nuclear positivity in squamous epithelial cells.
Immunohistochemical staining of human kidney shows moderate nuclear positivity in cells in tubules.
HPA019032-100ul
HPA019032-100ul
HPA019032-100ul