Anti-TET1

Catalog Number: ATA-HPA019032
Article Name: Anti-TET1
Biozol Catalog Number: ATA-HPA019032
Supplier Catalog Number: HPA019032
Alternative Catalog Number: ATA-HPA019032-100,ATA-HPA019032-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bA119F7.1, CXXC6, KIAA1676, LCX
tet methylcytosine dioxygenase 1
Anti-TET1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 80312
UniProt: Q8NFU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSSSNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSKSDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TET1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear membrane.
Immunohistochemical staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in purkinje cells.
Immunohistochemical staining of human cervix, uterine shows moderate nuclear positivity in squamous epithelial cells.
Immunohistochemical staining of human kidney shows moderate nuclear positivity in cells in tubules.
HPA019032-100ul
HPA019032-100ul
HPA019032-100ul