Anti-MPP6
Artikelnummer:
ATA-HPA019085
- Bilder (8)
| Artikelname: | Anti-MPP6 |
| Artikelnummer: | ATA-HPA019085 |
| Hersteller Artikelnummer: | HPA019085 |
| Alternativnummer: | ATA-HPA019085-100,ATA-HPA019085-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | p55T, PALS2, VAM-1 |
| membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6) |
| Anti-MPP6 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51678 |
| UniProt: | Q9NZW5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNNSSINNQLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARIL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MPP6 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and colon tissues using Anti-MPP6 antibody. Corresponding MPP6 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon shows low expression as expected. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Western blot analysis in human cell line SH-SY5Y. |
|
|
HPA019085-100ul |
|
|
|
|
|
HPA019085-100ul |
|
|
HPA019085-100ul |
Produktgarantie und fachkundiger Support
