Anti-MPP6
Catalog Number:
ATA-HPA019085
- Images (8)
| Article Name: | Anti-MPP6 |
| Biozol Catalog Number: | ATA-HPA019085 |
| Supplier Catalog Number: | HPA019085 |
| Alternative Catalog Number: | ATA-HPA019085-100,ATA-HPA019085-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | p55T, PALS2, VAM-1 |
| membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6) |
| Anti-MPP6 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 51678 |
| UniProt: | Q9NZW5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNNSSINNQLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARIL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MPP6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and colon tissues using Anti-MPP6 antibody. Corresponding MPP6 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon shows low expression as expected. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Western blot analysis in human cell line SH-SY5Y. |
|
|
HPA019085-100ul |
|
|
|
|
|
HPA019085-100ul |
|
|
HPA019085-100ul |
Product Guarantee and Expert Support
