Anti-SMARCB1
Artikelnummer:
ATA-HPA019127
- Bilder (7)
| Artikelname: | Anti-SMARCB1 |
| Artikelnummer: | ATA-HPA019127 |
| Hersteller Artikelnummer: | HPA019127 |
| Alternativnummer: | ATA-HPA019127-100,ATA-HPA019127-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BAF47, hSNFS, Ini1, PPP1R144, RDT, Sfh1p, SNF5, SNF5L1, Snr1 |
| SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 |
| Anti-SMARCB1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6598 |
| UniProt: | Q12824 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SMARCB1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human tonsil shows nuclear positivity. |
|
|
Western blot analysis using Anti-SMARCB1 antibody HPA019127 (A) shows similar pattern to independent antibody HPA018248 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA019127-100ul |
|
|
|
|
|
HPA019127-100ul |
|
|
HPA019127-100ul |
Produktgarantie und fachkundiger Support
