Anti-SMARCB1
Catalog Number:
ATA-HPA019127
- Images (7)
| Article Name: | Anti-SMARCB1 |
| Biozol Catalog Number: | ATA-HPA019127 |
| Supplier Catalog Number: | HPA019127 |
| Alternative Catalog Number: | ATA-HPA019127-100,ATA-HPA019127-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BAF47, hSNFS, Ini1, PPP1R144, RDT, Sfh1p, SNF5, SNF5L1, Snr1 |
| SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 |
| Anti-SMARCB1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6598 |
| UniProt: | Q12824 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SMARCB1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human tonsil shows nuclear positivity. |
|
|
Western blot analysis using Anti-SMARCB1 antibody HPA019127 (A) shows similar pattern to independent antibody HPA018248 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA019127-100ul |
|
|
|
|
|
HPA019127-100ul |
|
|
HPA019127-100ul |
Product Guarantee and Expert Support
