Anti-SMAD4 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA019154
Artikelname: Anti-SMAD4 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA019154
Hersteller Artikelnummer: HPA019154
Alternativnummer: ATA-HPA019154-100,ATA-HPA019154-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ICC, IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DPC4, MADH4
SMAD family member 4
Anti-SMAD4
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 4089
UniProt: Q13485
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: AFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SMAD4
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & centrosome.
Immunohistochemical staining of human rectum shows strong positivity in glandular cells.
Western blot analysis in human cell line SCLC-21H.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA019154
HPA019154
HPA019154