Anti-SMAD4

Catalog Number: ATA-HPA019154
Article Name: Anti-SMAD4
Biozol Catalog Number: ATA-HPA019154
Supplier Catalog Number: HPA019154
Alternative Catalog Number: ATA-HPA019154-100,ATA-HPA019154-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ChIP, ICC, IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DPC4, MADH4
SMAD family member 4
Anti-SMAD4
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 4089
UniProt: Q13485
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SMAD4
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & centrosome.
Immunohistochemical staining of human rectum shows strong positivity in glandular cells.
Western blot analysis in human cell line SCLC-21H.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA019154-100ul
HPA019154-100ul
HPA019154-100ul