Anti-STAU2

Artikelnummer: ATA-HPA019155
Artikelname: Anti-STAU2
Artikelnummer: ATA-HPA019155
Hersteller Artikelnummer: HPA019155
Alternativnummer: ATA-HPA019155-100,ATA-HPA019155-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: 39K2
staufen double-stranded RNA binding protein 2
Anti-STAU2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 27067
UniProt: None
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: STAU2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cell bodies and processes.
Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Western blot analysis in human cell line MOLT-4.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA019155-100ul
HPA019155-100ul
HPA019155-100ul