Anti-STAU2

Catalog Number: ATA-HPA019155
Article Name: Anti-STAU2
Biozol Catalog Number: ATA-HPA019155
Supplier Catalog Number: HPA019155
Alternative Catalog Number: ATA-HPA019155-100,ATA-HPA019155-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: 39K2
staufen double-stranded RNA binding protein 2
Anti-STAU2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 27067
UniProt: None
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: STAU2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cell bodies and processes.
Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Western blot analysis in human cell line MOLT-4.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA019155-100ul
HPA019155-100ul
HPA019155-100ul