Anti-CRAT Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA019230
Artikelname: Anti-CRAT Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA019230
Hersteller Artikelnummer: HPA019230
Alternativnummer: ATA-HPA019230-100,ATA-HPA019230-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CAT1
carnitine O-acetyltransferase
Anti-CRAT
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 1384
UniProt: P43155
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CRAT
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and lymph node tissues using HPA019230 antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows no positivity as expected.
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Western blot analysis using Anti-CRAT antibody HPA019230 (A) shows similar pattern to independent antibody HPA020260 (B).
Western blot analysis in human cell line TD47D.
HPA019230
HPA019230
HPA019230