Anti-CRAT

Catalog Number: ATA-HPA019230
Article Name: Anti-CRAT
Biozol Catalog Number: ATA-HPA019230
Supplier Catalog Number: HPA019230
Alternative Catalog Number: ATA-HPA019230-100,ATA-HPA019230-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAT1
carnitine O-acetyltransferase
Anti-CRAT
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 1384
UniProt: P43155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CRAT
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and lymph node tissues using HPA019230 antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows no positivity as expected.
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Western blot analysis using Anti-CRAT antibody HPA019230 (A) shows similar pattern to independent antibody HPA020260 (B).
Western blot analysis in human cell line TD47D.
HPA019230-100ul
HPA019230-100ul
HPA019230-100ul