Anti-DSCAM Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA019324
Artikelname: Anti-DSCAM Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA019324
Hersteller Artikelnummer: HPA019324
Alternativnummer: ATA-HPA019324-100,ATA-HPA019324-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CHD2-42, CHD2-52
Down syndrome cell adhesion molecule
Anti-DSCAM
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 1826
UniProt: O60469
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PRAQLLIEERDTMETIDDRSTVLLTDADFGEAAKQKSLTVTHTVHYQSVSQATGPLVDVSDARPGTNPTTRRNAKAGPTARNRYASQWTLNRPHPTISAHTLTTDWRLPTPRAAGSVDKESDSYSVSPSQDTDRARSS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DSCAM
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA019324 antibody. Corresponding DSCAM RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in cells in granular layer.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
HPA019324
HPA019324
HPA019324