Anti-DSCAM Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-DSCAM Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA019324
• Supplier Catalog Number: HPA019324
• Alternative Catalog Number: ATA-HPA019324-100,ATA-HPA019324-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CHD2-42, CHD2-52

Product Description

Down syndrome cell adhesion molecule

Additional Information

Anti-DSCAM

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 1826
• UniProt: O60469
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: PRAQLLIEERDTMETIDDRSTVLLTDADFGEAAKQKSLTVTHTVHYQSVSQATGPLVDVSDARPGTNPTTRRNAKAGPTARNRYASQWTLNRPHPTISAHTLTTDWRLPTPRAAGSVDKESDSYSVSPSQDTDRARSS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: DSCAM
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA019324 antibody. Corresponding DSCAM RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in cells in granular layer.

Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.

HPA019324

HPA019324

HPA019324