Anti-DSCAM

Catalog Number: ATA-HPA019324
Article Name: Anti-DSCAM
Biozol Catalog Number: ATA-HPA019324
Supplier Catalog Number: HPA019324
Alternative Catalog Number: ATA-HPA019324-100,ATA-HPA019324-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CHD2-42, CHD2-52
Down syndrome cell adhesion molecule
Anti-DSCAM
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 1826
UniProt: O60469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PRAQLLIEERDTMETIDDRSTVLLTDADFGEAAKQKSLTVTHTVHYQSVSQATGPLVDVSDARPGTNPTTRRNAKAGPTARNRYASQWTLNRPHPTISAHTLTTDWRLPTPRAAGSVDKESDSYSVSPSQDTDRARSS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DSCAM
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA019324 antibody. Corresponding DSCAM RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in cells in granular layer.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
HPA019324-100ul
HPA019324-100ul
HPA019324-100ul