Anti-DSCAM
Catalog Number:
ATA-HPA019324
- Images (9)
| Article Name: | Anti-DSCAM |
| Biozol Catalog Number: | ATA-HPA019324 |
| Supplier Catalog Number: | HPA019324 |
| Alternative Catalog Number: | ATA-HPA019324-100,ATA-HPA019324-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CHD2-42, CHD2-52 |
| Down syndrome cell adhesion molecule |
| Anti-DSCAM |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 1826 |
| UniProt: | O60469 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PRAQLLIEERDTMETIDDRSTVLLTDADFGEAAKQKSLTVTHTVHYQSVSQATGPLVDVSDARPGTNPTTRRNAKAGPTARNRYASQWTLNRPHPTISAHTLTTDWRLPTPRAAGSVDKESDSYSVSPSQDTDRARSS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DSCAM |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA019324 antibody. Corresponding DSCAM RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in cells in granular layer. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA019324-100ul |
|
|
|
|
|
HPA019324-100ul |
|
|
HPA019324-100ul |
Product Guarantee and Expert Support
