Anti-PTPN4, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-PTPN4, Rabbit, Polyclonal
• Artikelnummer: ATA-HPA019351
• Hersteller Artikelnummer: HPA019351
• Alternativnummer: ATA-HPA019351-100
• Hersteller: Atlas Antibodies
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, ICC, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Konjugation: Unconjugated
• Alternative Synonym: PTPMEG

Produktbeschreibung

protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte)

Zusatzinformationen

Anti-PTPN4

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.05 mg/ml
• Isotyp: IgG
• NCBI: 5775
• UniProt: P29074
• Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Reinheit: Affinity purified using the PrEST antigen as affinity ligand
• Sequenz: EQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFL
• Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Anwendungsbeschreibung

• Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml

Bilder

Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.

Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.

Immunohistochemical staining of human duodenum shows moderate positivity in apical membrane in glandular cells.

Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp